TWSG1 (Human) Recombinant Protein View larger

Human TWSG1 partial recombinant protein expressed in CHO cells.

AB-P9280

New product

TWSG1 (Human) Recombinant Protein

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 2 pontos de fidelização. Seu carrinho totalizará 2 pontos de fidelização que podem ser convertidos num vale de desconto de 8.00EUR.


Data sheet

Size 50 ug
Gene Name TWSG1
Gene Alias TSG
Gene Description twisted gastrulation homolog 1 (Drosophila)
Storage Conditions Lyophilized protein at room temperature for 3 weeks, should be stored at -20ºC. Protein aliquots at 4ºC for 2-7 days and should be stored at -20ºC to -80ºC. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). <br>Avoid repe
Immunogen Prot. Seq CNKALCASDVSKCLIQELCQCRPGEGNCSCCKECMLCLGALWDECCDCVGMCNPRNYSDTPPTSKSTVEELHEPIPSLFRALTEGDTQLNWNIVSFPVAEELSHHENLVSFLETVNQPHHQNVSVPSNNVHAPYSSDKEHMCTVVYFDDCMSIHQCKISCESMGASKYRWFHNACCECIGPECIDYGSKTVKCMNCMF
Form Lyophilized
Antigen species Target species Human
Storage Buffer Lyophilized from 1X PBS. Reconstitute the lyophilized powder in ddH<sub>2</sub>O to 100 ug/mL.
Gene ID 57045

More info

Human TWSG1 partial recombinant protein expressed in CHO cells.

Enviar uma mensagem

Human TWSG1 partial recombinant protein expressed in CHO cells.

Human TWSG1 partial recombinant protein expressed in CHO cells.