Tnf (Mouse) Recombinant Protein View larger

Mouse Tnf recombinant protein expressed in <i>Escherichia coli</i>.

AB-P9225

New product

Tnf (Mouse) Recombinant Protein

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 2 pontos de fidelização. Seu carrinho totalizará 2 pontos de fidelização que podem ser convertidos num vale de desconto de 8.00EUR.


Data sheet

Size 20 ug
Gene Name Tnf
Gene Alias DIF|MGC151434|TNF-alpha|TNFSF2|TNFalpha|Tnfa|Tnfsf1a
Gene Description tumor necrosis factor
Storage Conditions Lyophilized protein at room temperature for 3 weeks, should be stored at -20ºC. Protein aliquots at 4ºC for 2-7 days and should be stored at -20ºC to -80ºC. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). <br>Avoid repe
Immunogen Prot. Seq MLRSSSQNSSDKPVAHVVANHQVEEQLEWLSQRANALLANGMDLKDNQLVVPADGLYLVYSQVLFKGQGCPDYVLLTHTVSRFAISYQEKVNLLSAVKSPCPKDTPEGAELKPWYEPIYLGGVFQLEKGDQLSAEVNLPKYLDFAESGQVYFGVIAL
Form Lyophilized
Antigen species Target species Mouse
Storage Buffer Lyophilized from a solution containing 1X PBS, pH 7.2. Reconstitute the lyophilized powder in ddH<sub>2</sub>O to 100 ug/mL.
Gene ID 21926

More info

Mouse Tnf recombinant protein expressed in Escherichia coli.

Enviar uma mensagem

Mouse Tnf recombinant protein expressed in <i>Escherichia coli</i>.

Mouse Tnf recombinant protein expressed in <i>Escherichia coli</i>.