View larger
Human RBP7 full-length recombinant protein with His tag in N-terminus expressed in <i>Escherichia coli</i>.
AB-P9172
New product
RBP7 (Human) Recombinant Protein
Ao comprar este produto pode ganhar até 2 pontos de fidelização. Seu carrinho totalizará 2 pontos de fidelização que podem ser convertidos num vale de desconto de 8.00EUR.
Data sheet
| Size | 20 ug |
| Gene Name | RBP7 |
| Gene Alias | CRBP4|CRBPIV|MGC70641 |
| Gene Description | retinol binding protein 7, cellular |
| Storage Conditions | Store at 4ºC for 2-4 weeks and should be stored at -20ºC to -80ºC. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). <br>Avoid repeated freeze/thaw cycles. |
| Immunogen Prot. Seq | MGSSHHHHHHSSGLVPRGSHMPADLSGTWTLLSSDNFEGYMLALGIDFATRKIAKLLKPQKVIEQNGDSFTIHTNSSLRNYFVKFKVGEEFDEDNRGLDNRKCKSLVIWDNDRLTCIQKGEKKNRGWTHWIEGDKLHLEMFCEGQVCKQTFQRA |
| Form | Liquid |
| Antigen species Target species | Human |
| Storage Buffer | Solution (0.5 mg/mL) containing 20 mM Tris-HCl, pH 8.0, 20% glycerol, 0.2 M NaCl., 2 mM DTT. |
| Gene ID | 116362 |
More info
Human RBP7 full-length recombinant protein with His tag in N-terminus expressed in Escherichia coli.