View larger
Rat Retn recombinant protein with His tag in N-terminus expressed in <i>Escherichia coli</i>.
AB-P9163
New product
Retn (Rat) Recombinant Protein
Ao comprar este produto pode ganhar até 2 pontos de fidelização. Seu carrinho totalizará 2 pontos de fidelização que podem ser convertidos num vale de desconto de 8.00EUR.
Data sheet
| Size | 25 ug |
| Gene Name | Retn |
| Gene Alias | - |
| Gene Description | resistin |
| Storage Conditions | Lyophilized protein should be stored at -20ºC. Protein aliquots at 4ºC for 2 weeks. <br>Avoid repeated freeze/thaw cycles. |
| Immunogen Prot. Seq | MRGSHHHHHHGMASHMPSMSLCPMDEAISKKINQDFSSLLPAAMKNTVLHCWSVSSRGRLASCPEGTTVTSCSCGSGCGSWDVREDTMCHCQCGSIDWTAARCCTLRVGS |
| Form | Lyophilized |
| Antigen species Target species | Rat |
| Storage Buffer | Protein (0.5 mg/mL) was lyophilized from a solution containing 20 mM Tris-HCl, pH 8.0. Reconstitute the lyophilized powder in ddH<sub>2</sub>O to 0.5mg/mL and let the lyophilized pellet dissolve completely, and is not sterile! Please filter the product by |
| Gene ID | 246250 |
More info
Rat Retn recombinant protein with His tag in N-terminus expressed in Escherichia coli.