View larger
Mouse Shh partial recombinant protein with His tag in C-terminus expressed in <i>Escherichia coli</i>.
AB-P9134
New product
Shh (Mouse) Recombinant Protein
Ao comprar este produto pode ganhar até 2 pontos de fidelização. Seu carrinho totalizará 2 pontos de fidelização que podem ser convertidos num vale de desconto de 8.00EUR.
Data sheet
| Size | 25 ug |
| Gene Name | Shh |
| Gene Alias | 9530036O11Rik|Dsh|Hhg1|Hx|Hxl3|M100081 |
| Gene Description | sonic hedgehog |
| Storage Conditions | Store at 4ºC for 2-4 weeks and should be stored at -20ºC to -80ºC. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). <br>Avoid repeated freeze/thaw cycles. |
| Immunogen Prot. Seq | MCGPGRGFGKRRHPKKLTPLAYKQFIPNVAEKTLGASGRYEGKITRNSERFKELTPNYNPDIIFKDEENTGADRLMTQRCKDKLNALAISVMNQWPGVKLRVTEGWDEDGHHSEESLHYEGRAVDITTSDRDRSKYGMLARLAVEAGFDWVYYESKAHIHCSVKAENSVAAKSGGLEHHHHHH |
| Form | Liquid |
| Antigen species Target species | Mouse |
| Storage Buffer | Solution containing 20 mM Tris-HCl, pH 8.0, 10% glycerol, 1 mM DTT. |
| Gene ID | 20423 |
| Iso type | Escherichia Coli. |
More info
Mouse Shh partial recombinant protein with His tag in C-terminus expressed in Escherichia coli.