View larger
Human CD79A (P11912, 33 a.a. - 143 a.a.) partial-length recombinant protein with His tag at C-Terminus expressed in <i>Baculovir
AB-P9104
New product
CD79A (Human) Recombinant Protein
Ao comprar este produto pode ganhar até 4 pontos de fidelização. Seu carrinho totalizará 4 pontos de fidelização que podem ser convertidos num vale de desconto de 16.00EUR.
Data sheet
| Size | 2 x 10 ug |
| Gene Name | CD79A |
| Gene Alias | IGA|MB-1 |
| Gene Description | CD79a molecule, immunoglobulin-associated alpha |
| Storage Conditions | Store at -20ºC. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles. |
| Immunogen Prot. Seq | LWMHKVPASLMVSLGEDAHFQCPHNSSNNANVTWWRVLHGNYTWPPEFLGPGEDPNGTLIIQNVNKSHGGIYVCRVQEGNESYQQSCGTYLRVRQPPPRPFLDMGEGTKNRLEHHHHHH. |
| Form | Liquid |
| Antigen species Target species | Human |
| Storage Buffer | PBS (pH7.4) and 10% glycerol. |
| Gene ID | 973 |
More info
Human CD79A (P11912, 33 a.a. - 143 a.a.) partial-length recombinant protein with His tag at C-Terminus expressed in Baculovirus.