View larger
Human CD72 (P21854, 117 a.a. - 359 a.a.) partial-length recombinant protein with His tag at C-Terminus expressed in <i>Baculovir
AB-P9103
New product
CD72 (Human) Recombinant Protein
Ao comprar este produto pode ganhar até 4 pontos de fidelização. Seu carrinho totalizará 4 pontos de fidelização que podem ser convertidos num vale de desconto de 16.00EUR.
Data sheet
| Size | 2 x 10 ug |
| Gene Name | CD72 |
| Gene Alias | CD72b|LYB2 |
| Gene Description | CD72 molecule |
| Storage Conditions | Store at -20ºC. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles. |
| Immunogen Prot. Seq | ADPRYLQVSQQLQQTNRVLEVTNSSLRQQLRLKITQLGQSAEDLQGSRRELAQSQEALQVEQRAHQAAEGQLQACQADRQKTKETLQSEEQQRRALEQKLSNMENRLKPFFTCGSADTCCPSGWIMHQKSCFYISLTSKNWQESQKQCETLSSKLATFSEIYPQSHSYYFLNSLLPNGGSGNSYWTGLSSNKDWKLTDDTQRTRTYAQSSKCNKVHKTWSWWTLESESCRSSLPYICEMTAFRFPDLEPKSCDKT |
| Form | Liquid |
| Antigen species Target species | Human |
| Storage Buffer | 50mM Tris-HCl buffer (pH6.8), 0.2M NaCl, 2mM DTT and 50% glycerol. |
| Gene ID | 971 |
More info
Human CD72 (P21854, 117 a.a. - 359 a.a.) partial-length recombinant protein with His tag at C-Terminus expressed in Baculovirus.