View larger
Human PDGFD (Q9GZP0, 250 a.a. - 370 a.a.) partial-length recombinant protein with His tag at N-Terminus expressed in <i>Escheric
AB-P9016
New product
PDGFD (Human) Recombinant Protein
Ao comprar este produto pode ganhar até 2 pontos de fidelização. Seu carrinho totalizará 2 pontos de fidelização que podem ser convertidos num vale de desconto de 8.00EUR.
Data sheet
| Size | 20 ug |
| Gene Name | PDGFD |
| Gene Alias | IEGF|MGC26867|MSTP036|SCDGF-B|SCDGFB |
| Gene Description | platelet derived growth factor D |
| Storage Conditions | Store, frozen at -20ºC for longer periods of time.<br>For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).<br>Avoid multiple freeze-thaw cycles. |
| Immunogen Prot. Seq | MGSSHHHHHHSSGLVPRGSHMGSHMSYHDRKSKVDLDRLNDDAKRYSCTPRNYSVNIREELKLANVVFFPRCLLVQRCGGNCGCGTVNWRSCTCNSGKTVKKYHEVLQFEPGHIKRRGRAKTMALVDIQLDHHERCDCICSSRPPR. |
| Form | Liquid |
| Antigen species Target species | Human |
| Storage Buffer | 20mM Tris-HCl buffer (pH 8.0), 0.4M Urea and 10% glycerol. |
| Gene ID | 80310 |
More info
Human PDGFD (Q9GZP0, 250 a.a. - 370 a.a.) partial-length recombinant protein with His tag at N-Terminus expressed in Escherichia coli.