View larger
Human NOV (P48745, 33 a.a. - 357 a.a.) partial-length recombinant protein with His tag at C-Terminus expressed in HEK293 cell.
AB-P8978
New product
NOV (Human) Recombinant Protein
Ao comprar este produto pode ganhar até 4 pontos de fidelização. Seu carrinho totalizará 4 pontos de fidelização que podem ser convertidos num vale de desconto de 16.00EUR.
Data sheet
| Size | 2 x 10 ug |
| Gene Name | NOV |
| Gene Alias | CCN3|IGFBP9 |
| Gene Description | nephroblastoma overexpressed gene |
| Storage Conditions | Store at -20ºC. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles. |
| Immunogen Prot. Seq | QRCPPQCPGRCPATPPTCAPGVRAVLDGCSCCLVCARQRGESCSDLEPCDESSGLYCDRSADPSNQTGICTAVEGDNCVFDGVIYRSGEKFQPSCKFQCTCRDGQIGCVPRCQLDVLLPEPNCPAPRKVEVPGECCEKWICGPDEEDSLGGLTLAAYRPEATLGVEVSDSSVNCIEQTTEWTACSKSCGMGFSTRVTNRNRQCEMLKQTRLCMVRPCEQEPEQPTDKKGKKCLRTKKSLKAIHLQFKNCTSLHTY |
| Form | Lyophilized |
| Antigen species Target species | Human |
| Storage Buffer | Lyophilized from PBS and 5 % (w/v) trehalose. |
| Gene ID | 4856 |
More info
Human NOV (P48745, 33 a.a. - 357 a.a.) partial-length recombinant protein with His tag at C-Terminus expressed in HEK293 cell.