View larger
Porcine Csf2 recombinant protein expressed in?<i>Escherichia coli</i>.
AB-P8748
New product
Csf2 (Porcine) Recombinant Protein
Ao comprar este produto pode ganhar até 12 pontos de fidelização. Seu carrinho totalizará 12 pontos de fidelização que podem ser convertidos num vale de desconto de 48.00EUR.
Data sheet
| Size | 100 ug |
| Gene Name | Csf2 |
| Gene Alias | Gm-csf|Gmcsf |
| Gene Description | colony stimulating factor 2 (granulocyte-macrophage) |
| Storage Conditions | Lyophilized protein at room temperature for 3 weeks, should be stored at -20ºC. Protein aliquots at 4ºC for 2-7 days and should be stored at -20ºC to -80ºC. <br>Avoid repeated freeze/thaw cycles. |
| Immunogen Prot. Seq | MAPTRPPSPVTRPWQHVDAIKEALSLLNNSNDTAAVMNETVDVVCEMFDPQEPTCVQTRLNLYKQGLRGSLTRLKSPLTLLAKHYEQHCPLTEETSCETQSITFKSFKDSLNKFLFTIPFDCWGPVKK |
| Form | Lyophilized |
| Antigen species Target species | Pig |
| Storage Buffer | Protein (1 mg/mL) was lyophilized from a solution containing 10 mM sodium phosphate buffer, pH 7.5. Reconstitute the lyophilized powder in ddH<sub>2</sub>O to 100 ug/mL. |
| Gene ID | 116630 |
More info
Porcine Csf2 recombinant protein expressed in?Escherichia coli.