View larger
Human GDNF partial recombinant protein with His tag in N-terminus expressed in Baculovirus.
AB-P8682
New product
GDNF (Human) Recombinant Protein
Ao comprar este produto pode ganhar até 4 pontos de fidelização. Seu carrinho totalizará 4 pontos de fidelização que podem ser convertidos num vale de desconto de 16.00EUR.
Data sheet
| Size | 2 x 10 ug |
| Gene Name | GH1 |
| Gene Alias | GH|GH-N|GHN|hGH-N |
| Gene Description | growth hormone 1 |
| Storage Conditions | Store at 4ºC for 2-4 weeks and should be stored at -20ºC to -80ºC. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). <br>Avoid repeated freeze/thaw cycles. |
| Immunogen Prot. Seq | ADPMRGQRGKNRGCVLTAIHLNVTDLGLGYETKEELIFRYCSGSCDAAETTYDKILKNLSRNRRLVSDKVGQACCRPIAFDDDLSFLDDNLVYHILRKHSAKRCGCIHHHHHH |
| Form | Liquid |
| Antigen species Target species | Human |
| Storage Buffer | Solution (0.25 mg/mL) containing 1X PBS, pH 7.4, 10% glycerol. |
| Gene ID | 2688 |
More info
Human GDNF partial recombinant protein with His tag in N-terminus expressed in Baculovirus.