View larger
Mouse Lgals3 full-length recombinant protein with His tag in N-terminus expressed in <i>Escherichia coli</i>.
AB-P8666
New product
Lgals3 (Mouse) Recombinant Protein
Ao comprar este produto pode ganhar até 4 pontos de fidelização. Seu carrinho totalizará 4 pontos de fidelização que podem ser convertidos num vale de desconto de 16.00EUR.
Data sheet
| Size | 2 x 10 ug |
| Gene Name | Lgals3 |
| Gene Alias | GBP|L-34|Mac-2|gal3 |
| Gene Description | lectin, galactose binding, soluble 3 |
| Storage Conditions | Store at 4ºC for 2-4 weeks and should be stored at -20ºC to -80ºC. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). <br>Avoid repeated freeze/thaw cycles. |
| Immunogen Prot. Seq | MGSSHHHHHHSSGLVPRGSHMGSMADSFSLNDALAGSGNPNPQGYPGAWGNQPGAGGYPGAAYPGAYPGQAPPGAYPGQAPPGAYPGQAPPSAYPGPTAPGAYPGPTAPGAYPGSTAPGAFPGQPGAPGAYPSAPGGYPAAGPYGVPAGPLTVPYDLPLPGGVMPRMLITIMGTVKPNANRIVLDFRRGNDVAFHFNPRFNENNRRVIVCNTKQDNNWGKEERQSAFPFESGKPFKIQVLVEADHFKVAVNDAHL |
| Form | Liquid |
| Antigen species Target species | Mouse |
| Storage Buffer | Solution (0.5 mg/mL) containing 20 mM Tris-HCl, pH 8.0, 50% glycerol, 0.15 M NaCl, 1 mM DTT, 2 mM EDTA. |
| Gene ID | 16854 |
More info
Mouse Lgals3 full-length recombinant protein with His tag in N-terminus expressed in Escherichia coli.