AB-P8646
New product
This product is no longer in stock
Availability date:
Ao comprar este produto pode ganhar até 2 pontos de fidelização. Seu carrinho totalizará 2 pontos de fidelização que podem ser convertidos num vale de desconto de 8.00EUR.
Size | 5 ug |
Gene Name | Flt3l |
Gene Alias | Flt3lg|Ly72L |
Gene Description | FMS-like tyrosine kinase 3 ligand |
Storage Conditions | Store at 4ºC for 2-4 weeks and should be stored at -20ºC to -80ºC. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). <br>Avoid repeated freeze/thaw cycles. |
Immunogen Prot. Seq | GTPDCYFSHSPISSNFKVKFRELTDHLLKDYPVTVAVNLQDEKHCKALWSLFLAQRWIEQLKTVAGSKMQTLLEDVNTEIHFVTSCTFQPLPECLRFVQTNISHLLKDTCTQLLALKPCIGKACQNFSRCLEVQCQPDSSTLLPPRSPIALEATELPEPRPRQHHHHHH |
Form | Liquid |
Antigen species Target species | Mouse |
Storage Buffer | Solution (0.5 mg/mL) containing��1X PBS, pH 7.4,10% glycerol. |
Gene ID | 14256 |