FAS (Human) Recombinant Protein View larger

Human FAS recombinant protein with His tag in C-terminus expressed in?<i>Escherichia coli</i>.

AB-P8580

New product

FAS (Human) Recombinant Protein

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 2 pontos de fidelização. Seu carrinho totalizará 2 pontos de fidelização que podem ser convertidos num vale de desconto de 8.00EUR.


Data sheet

Size 20 ug
Gene Name FAS
Gene Alias ALPS1A|APO-1|APT1|CD95|FAS1|FASTM|TNFRSF6
Gene Description Fas (TNF receptor superfamily, member 6)
Storage Conditions Lyophilized protein at room temperature for 3 weeks, should be stored at -20ºC. Protein aliquots at 4ºC for 2-7 days and should be stored at -20ºC to -80ºC. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA) <br>Avoid repea
Immunogen Prot. Seq MRLSSKSVNAQVTDINSKGLELRKTVTTVETQNLEGLHHDGQFCHKPCPPGERKARDCTVNGDEPDCVPCQEGKEYTDKAHFSSKCRRCRLCDEGHGLEVEINCTRTQNTKCRCKPNFFCNSTVCEHCDPCTKCEHGIIKECTLTSNTKCKEEGSRS
Form Lyophilized
Antigen species Target species Human
Storage Buffer Lyophilized from a solution containing 1X PBS, pH7.4. Reconstitute the lyophilized powder in ddH<sub>2</sub>O to 100 ug/mL.
Gene ID 355

More info

Human FAS recombinant protein with His tag in C-terminus expressed in?Escherichia coli.

Enviar uma mensagem

Human FAS recombinant protein with His tag in C-terminus expressed in?<i>Escherichia coli</i>.

Human FAS recombinant protein with His tag in C-terminus expressed in?<i>Escherichia coli</i>.