Eng (Mouse) Recombinant Protein View larger

Mouse Eng (Q63961, 27a.a. - 581 a.a.) partial-length recombinant protein with His-tag at C-terminal expressed in <i>Baculovirus<

AB-P8564

New product

Eng (Mouse) Recombinant Protein

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 2 pontos de fidelização. Seu carrinho totalizará 2 pontos de fidelização que podem ser convertidos num vale de desconto de 8.00EUR.


Data sheet

Size 5 ug
Gene Name Eng
Gene Alias AI528660|AI662476|CD105|S-endoglin
Gene Description endoglin
Storage Conditions Store at -20ºC. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles.
Immunogen Prot. Seq ERVGCDLQPVDPTRGEVTFTTSQVSEGCVAQAANAVREVHVLFLDFPGMLSHLELTLQASKQNGTETQEVFLVLVSNKNVFVKFQAPEIPLHLAYDSSLVIFQGQPRVNITVLPSLTSRKQILDWAATKGAITSIAALDDPQSIVLQLGQDPKAPFLCLPEAHKDMGATLEWQPRAQTPVQSCRLEGVSGHKEAYILRILPGSEAGPRTVTVMMELSCTSGDAILILHGPPYVSWFIDINHSMQILTTGEYSVKI
Form Liquid
Antigen species Target species Mouse
Storage Buffer Endoglin protein solution (0.5mg/ml) containing Phosphate Buffered Saline (pH 7.4) and 10% glycerol.
Gene ID 13805

More info

Mouse Eng (Q63961, 27a.a. - 581 a.a.) partial-length recombinant protein with His-tag at C-terminal expressed in Baculovirus.

Enviar uma mensagem

Mouse Eng (Q63961, 27a.a. - 581 a.a.) partial-length recombinant protein with His-tag at C-terminal expressed in <i>Baculovirus<

Mouse Eng (Q63961, 27a.a. - 581 a.a.) partial-length recombinant protein with His-tag at C-terminal expressed in <i>Baculovirus<