View larger
Human CLCF1 (Q9UBD9, 28 a.a. - 225 a.a) partial-length recombinant protein with His-tag at N-terminal expressed in <i>Escherichi
AB-P8505
New product
CLCF1 (Human) Recombinant Protein
Ao comprar este produto pode ganhar até 2 pontos de fidelização. Seu carrinho totalizará 2 pontos de fidelização que podem ser convertidos num vale de desconto de 8.00EUR.
Data sheet
| Size | 20 ug |
| Gene Name | CLCF1 |
| Gene Alias | BSF3|CISS2|CLC|NNT1|NR6 |
| Gene Description | cardiotrophin-like cytokine factor 1 |
| Storage Conditions | Store at -20ºC. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles. |
| Immunogen Prot. Seq | MGSSHHHHHHSSGLVPRGSHMLNRTGDPGPGPSIQKTYDLTRYLEHQLRSLAGTYLNYLGPPFNEPDFNPPRLGAETLPRATVDLEVWRSLNDKLRLTQNYEAYSHLLCYLRGLNRQAATAELRRSLAHFCTSLQGLLGSIAGVMAALGYPLPQPLPGTEPTWTPGPAHSDFLQKMDDFWLLKELQTWLWRSAKDFNRLKKKMQPPAAAVTLHLGAHGF. |
| Form | Liquid |
| Antigen species Target species | Human |
| Storage Buffer | CLCF1 protein solution (1mg/mL) containing 20mM sodium citrate (pH 3.5), 0.4M Urea and 10% glycerol. |
| Gene ID | 23529 |
More info
Human CLCF1 (Q9UBD9, 28 a.a. - 225 a.a) partial-length recombinant protein with His-tag at N-terminal expressed in Escherichia coli.