View larger
Human BTC (P35070, 32 a.a. - 111 a.a) partial-length recombinant protein with His-tag at N-terminal expressed in <i>Escherichia
AB-P8498
New product
BTC (Human) Recombinant Protein
Ao comprar este produto pode ganhar até 4 pontos de fidelização. Seu carrinho totalizará 4 pontos de fidelização que podem ser convertidos num vale de desconto de 16.00EUR.
Data sheet
| Size | 2 x 10 ug |
| Gene Name | BTC |
| Gene Alias | - |
| Gene Description | betacellulin |
| Storage Conditions | Store at -20ºC. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles. |
| Immunogen Prot. Seq | MGSSHHHHHHSSGLVPRGSHMDGNSTRSPETNGLLCGDPEENCAATTTQSKRKGHFSRCPKQYKHYCIKGRCRFVVAEQTPSCVCDEGYIGARCERVDLFY. |
| Form | Liquid |
| Antigen species Target species | Human |
| Storage Buffer | The BTC solution (0.25mg/mL) contains 20mM Tris-HCl buffer (pH 8.0), 5mM DTT, 0.2M NaCl and 20% glycerol. |
| Gene ID | 685 |
More info
Human BTC (P35070, 32 a.a. - 111 a.a) partial-length recombinant protein with His-tag at N-terminal expressed in Escherichia coli.