View larger
Mouse Ngf (P01139) recombinant protein produced in Submaxillary Gland of Grown Mouse.
AB-P8487
New product
Ngf (Mouse) Recombinant Protein
Ao comprar este produto pode ganhar até 2 pontos de fidelização. Seu carrinho totalizará 2 pontos de fidelização que podem ser convertidos num vale de desconto de 8.00EUR.
Data sheet
| Size | 20 ug |
| Gene Name | Ngf |
| Gene Alias | Ngfb |
| Gene Description | nerve growth factor |
| Storage Conditions | Store at -20ºC. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles. |
| Immunogen Prot. Seq | SSTHPVFHMGEFSVCDSVSVWVGDKTTATDIKGKEVTVLAEVNINNSVFRQYFFETKCRASNPVESGCRGIDSKHWNSYCTTTHTFVKALTTDEKQAAWRFIRIDTACVCVLSRKATRRG. |
| Form | Lyophilized |
| Antigen species Target species | Mouse |
| Storage Buffer | The NGF beta Mouse was lyophilized from solution containing 5% mannitol and 1% HSA. |
| Gene ID | 18049 |
More info
Mouse Ngf (P01139) recombinant protein produced in Submaxillary Gland of Grown Mouse.