View larger
Human BMP3 (P12645) recombinant protein expressed in <i>Escherichia coli</i>.
AB-P8472
New product
BMP3 (Human) Recombinant Protein
Ao comprar este produto pode ganhar até 2 pontos de fidelização. Seu carrinho totalizará 2 pontos de fidelização que podem ser convertidos num vale de desconto de 8.00EUR.
Data sheet
| Size | 50 ug |
| Gene Name | BMP3 |
| Gene Alias | BMP-3A |
| Gene Description | bone morphogenetic protein 3 |
| Storage Conditions | Store at -20ºC. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles. |
| Immunogen Prot. Seq | QWIEPRNCARRYLKVDFADIGWSEWIISPKSFDAYYCSGACQFPMPKSLKPSNHATIQSIVRAVGVVPGIPEPCCVPEKMSSLSILFFDENKNVVLKVYPNMTVESCACR. |
| Form | Lyophilized |
| Antigen species Target species | Human |
| Storage Buffer | BMP-3 protein was lyophilized from a 0.2um filtered concentrated solution in 30% Acetonitrile and 0.1% TFA. |
| Gene ID | 651 |
More info
Human BMP3 (P12645) recombinant protein expressed in Escherichia coli.