CLU (Dog) Recombinant Protein View larger

Dog CLU (P25473) recombinant protein with FLAG-tag at N-terminal expressed in HEK293 cells.

AB-P8437

New product

CLU (Dog) Recombinant Protein

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 4 pontos de fidelização. Seu carrinho totalizará 4 pontos de fidelização que podem ser convertidos num vale de desconto de 16.00EUR.


Data sheet

Size 2 x 10 ug
Gene Name CLU
Gene Alias GP80
Gene Description clusterin
Storage Conditions Store at -20ºC. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles.
Immunogen Prot. Seq PGDYKDDDDKPAGDQAVSDTELQEMSTEGSKYINKEIKNALKGVKQIKTLIEQTNEERKSLLSNLEEAKKKKEDALNDTKDSETKLKASQGVCNDTMMALWEECKPCLKQTCMKFYARVCRSGSGLVGHQLEEFLNQSSPFYFWMNGDRIDSLLENDRQQTHALDVMQDSFNRASSIMDELFQDRFFTREPQDTYHYSPFSLFQRRPFFNPKFRIARNIIPFPRFQPLNFHDMFQPFFDMIHQAQQAMDVNLHRI
Form Lyophilized
Antigen species Target species Dog
Storage Buffer Lyophilized from 20mM Tris buffer and 20mM NaCl, pH 7.5.
Gene ID 442971

More info

Dog CLU (P25473) recombinant protein with FLAG-tag at N-terminal expressed in HEK293 cells.

Enviar uma mensagem

Dog CLU (P25473) recombinant protein with FLAG-tag at N-terminal expressed in HEK293 cells.

Dog CLU (P25473) recombinant protein with FLAG-tag at N-terminal expressed in HEK293 cells.