Clu (Rat) Recombinant Protein View larger

Rat Clu (P05371) recombinant protein with T7-tag at N-terminal fusion and His-tag at C-terminal expressed in <i>Escherichia coli

AB-P8435

New product

Clu (Rat) Recombinant Protein

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 4 pontos de fidelização. Seu carrinho totalizará 4 pontos de fidelização que podem ser convertidos num vale de desconto de 16.00EUR.


Data sheet

Size 2 x 10 ug
Gene Name Clu
Gene Alias APOJ|CLI|RATTRPM2B|SGP-2|SGP2|SP-40|TRPM-2|TRPM2B|Trpm2|Trpmb
Gene Description clusterin
Storage Conditions Store at -20ºC. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles.
Immunogen Prot. Seq MASMTGGQQMGRDPNSSSPFYFWMNGDRIDSLLESDRQQSQVLDAMQDSFTRASGIIDTLFQDRFFTHEPQDIHHFSPMGFPHKRPHLLYPKSRLVRSLMPLSHYGPLSFHNMFQPFFDMIHQAQQAMDVQLHSPALQFPDVDFLKEGEDDRTVCKEIRHNSTGCLKMKGQCEKCQEILSVDCSTNNPAQANLRQELNDSLQVAERLTQQYNELLHSLQSKMLNTSSLLEQALEHHHHHH.
Form Lyophilized
Antigen species Target species Rat
Storage Buffer Lyophilized from 0.02M Tris buffer and 0.05M NaCl, pH 7.5.
Gene ID 24854

More info

Rat Clu (P05371) recombinant protein with T7-tag at N-terminal fusion and His-tag at C-terminal expressed in Escherichia coli.

Enviar uma mensagem

Rat Clu (P05371) recombinant protein with T7-tag at N-terminal fusion and His-tag at C-terminal expressed in <i>Escherichia coli

Rat Clu (P05371) recombinant protein with T7-tag at N-terminal fusion and His-tag at C-terminal expressed in <i>Escherichia coli