View larger
Human APOA1 (P02647, 25-267 a.a.) partial-length recombinant protein with His-tag at N-terminal expressed in <i>Escherichia coli
AB-P8418
New product
APOA1 (Human) Recombinant Protein
Ao comprar este produto pode ganhar até 4 pontos de fidelização. Seu carrinho totalizará 4 pontos de fidelização que podem ser convertidos num vale de desconto de 16.00EUR.
Data sheet
| Size | 100 ug |
| Gene Name | APOA1 |
| Gene Alias | MGC117399 |
| Gene Description | apolipoprotein A-I |
| Storage Conditions | Store, frozen at -20ºC for longer periods of time.<br>For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).<br>Avoid multiple freeze-thaw cycles. |
| Immunogen Prot. Seq | MGSSHHHHHHSSGLVPRGSHMDEPPQSPWDRVKDLATVYVDVLKDSGRDYVSQFEGSALGKQLNLKLLDNWDSVTSTFSKLREQLGPVTQEFWDNLEKETEGLRQEMSKDLEEVKAKVQPYLDDFQKKWQEEMELYRQKVEPLRAELQEGARQKLHELQEKLSPLGEEMRDRARAHVDALRTHLAPYSDELRQRLAARLEALKENGGARLAEYHAKATEHLSTLSEKAKPALEDLRQGLLPVLESFKVSFLSALE |
| Form | Liquid |
| Antigen species Target species | Human |
| Storage Buffer | 20mM Tris-HCl buffer (pH8.0) and 10% glycerol. |
| Gene ID | 335 |
More info
Human APOA1 (P02647, 25-267 a.a.) partial-length recombinant protein with His-tag at N-terminal expressed in Escherichia coli.