View larger
Human ANGPTL7 (O43827, 27 a.a. - 346 a.a.) partial-length recombinant protein expressed in HEK293 cells.
AB-P8415
New product
ANGPTL7 (Human) Recombinant Protein
Ao comprar este produto pode ganhar até 4 pontos de fidelização. Seu carrinho totalizará 4 pontos de fidelização que podem ser convertidos num vale de desconto de 16.00EUR.
Data sheet
| Size | 2 x 10 ug |
| Gene Name | ANGPTL7 |
| Gene Alias | AngX|CDT6|RP4-647M16.2|dJ647M16.1 |
| Gene Description | angiopoietin-like 7 |
| Storage Conditions | Store, frozen at -20ºC for longer periods of time.<br>For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).<br>Avoid multiple freeze-thaw cycles. |
| Immunogen Prot. Seq | QKLSKHKTPAQPQLKAANCCEEVKELKAQVANLSSLLSELNKKQERDWVSVVMQVMELESNSKRMESRLTDAESKYSEMNNQIDIMQLQAAQTVTQTSADAIYDCSSLYQKNYRISGVYKLPPDDFLGSPELEVFCDMETSGGGWTIIQRRKSGLVSFYRDWKQYKQGFGSIRGDFWLGNEHIHRLSRQPTRLRVEMEDWEGNLRYAEYSHFVLGNELNSYRLFLGNYTGNVGNDALQYHNNTAFSTKDKDNDNC |
| Form | Liquid |
| Antigen species Target species | Human |
| Storage Buffer | 10% glycerol and Phosphate-Buffered Saline (pH 7.4). |
| Gene ID | 10218 |
More info
Human ANGPTL7 (O43827, 27 a.a. - 346 a.a.) partial-length recombinant protein expressed in HEK293 cells.