View larger
Human ANGPTL3 (Q9Y5C1, 26 a.a. - 233 a.a.) partial-length recombinant protein with His-tag at N-terminal expressed in <i>Escheri
AB-P8408
New product
ANGPTL3 (Human) Recombinant Protein
Ao comprar este produto pode ganhar até 4 pontos de fidelização. Seu carrinho totalizará 4 pontos de fidelização que podem ser convertidos num vale de desconto de 16.00EUR.
Data sheet
| Size | 2 x 10 ug |
| Gene Name | ANGPTL3 |
| Gene Alias | ANGPT5 |
| Gene Description | angiopoietin-like 3 |
| Storage Conditions | Store at -20ºC. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles. |
| Immunogen Prot. Seq | MRGSHHHHHHGMASHMSRIDQDNSSFDSLSPEPKSRFAMLDDVKILANGLLQLGHGLKDFVHKTKGQINDIFQKLNIFDQSFYDLSLQTSEIKEEEKELRRTTYKLQVKNEEVKNMSLELNSKLESLLEEKILLQQKVKYLEEQLTNLIQNQPETPEHPEVTSLKTFVEKQDNSIKDLLQTVEDQYKQLNQQHSQIKEIENQLRRTSIQEPTEISLSSKPRAP. |
| Form | Lyophilized |
| Antigen species Target species | Human |
| Storage Buffer | Lyophilized from 0.05M Acetate buffer pH-4. |
| Gene ID | 27329 |
More info
Human ANGPTL3 (Q9Y5C1, 26 a.a. - 233 a.a.) partial-length recombinant protein with His-tag at N-terminal expressed in Escherichia coli.