View larger
Human AIF1 (P55008) recombinant protein with His-tag at N-terminal expressed in <i>Escherichia coli</i>.
AB-P8399
New product
AIF1 (Human) Recombinant Protein
Ao comprar este produto pode ganhar até 4 pontos de fidelização. Seu carrinho totalizará 4 pontos de fidelização que podem ser convertidos num vale de desconto de 16.00EUR.
Data sheet
| Size | 2 x 10 ug |
| Gene Name | AIF1 |
| Gene Alias | AIF-1|IBA1|IRT-1 |
| Gene Description | allograft inflammatory factor 1 |
| Storage Conditions | For long term, store at -20ºC. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles. |
| Immunogen Prot. Seq | MKHHHHHHASQTRDLQGGKAF¬GLLKAQQEERLDE-INKQFLDDPKYSSDED¬LPSKLEGFKEKYMEF¬DLNGNGDIDIMSLKRMLEK-LGVPKTHLELKKLI¬GEVSSGSGETFSYP¬DFLRMMLGKRSAIL-KMILMYEEKAREKEK¬PTGPPAKKAISELP. |
| Form | Lyophilized |
| Antigen species Target species | Human |
| Storage Buffer | Lyophilized from 20mM Tris buffer and 50mM NaCl pH-7.5. |
| Gene ID | 199 |
More info
Human AIF1 (P55008) recombinant protein with His-tag at N-terminal expressed in Escherichia coli.