View larger
Mouse Il4 (P07750, 21 a.a. - 140 a.a.) partial recombinant protein expressed in <i>Escherichia coli</i>.
AB-P8269
New product
Il4 (Mouse) Recombinant Protein
Ao comprar este produto pode ganhar até 2 pontos de fidelização. Seu carrinho totalizará 2 pontos de fidelização que podem ser convertidos num vale de desconto de 8.00EUR.
Data sheet
| Size | 20 ug |
| Gene Name | Il4 |
| Gene Alias | Il-4 |
| Gene Description | interleukin 4 |
| Storage Conditions | Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Immunogen Prot. Seq | MHIHGCDKNHLREIIGILNEVTGEGTPCTEMDVPNVLTATKNTTESELVCRASKVLRIFYLKHGKTPCLKKNSSVLMELQRLFRAFRCLDSSISCTMNESKSTSLKDFLESLKSIMQMDYS |
| Form | Lyophilized |
| Recomended Dilution | Biological Activity<br>SDS-PAGE<br>The optimal working dilution should be determined by the end user. |
| Storage Buffer | In sterile 10mM HAc > |
| Gene ID | 16189 |
More info
Mouse Il4 (P07750, 21 a.a. - 140 a.a.) partial recombinant protein expressed in Escherichia coli.