View larger
Human IL4 (P05112, 25 a.a. - 153 a.a.) partial recombinant protein with His tag at N-terminus expressed in <i>Escherichia coli</
AB-P8267
New product
IL4 (Human) Recombinant Protein
Ao comprar este produto pode ganhar até 4 pontos de fidelização. Seu carrinho totalizará 4 pontos de fidelização que podem ser convertidos num vale de desconto de 16.00EUR.
Data sheet
| Size | 2 x 10 ug |
| Gene Name | IL4 |
| Gene Alias | BCGF-1|BCGF1|BSF1|IL-4|MGC79402 |
| Gene Description | interleukin 4 |
| Storage Conditions | Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Immunogen Prot. Seq | MGSSHHHHHHSSGLVPRGSHMHKCDITLQEIIKTLNSLTEQKTLCTELTVTDIFAASKNTTEKETFCRAATVLRQFYSHHEKDTRCLGATAQQFHRHKQLIRFLKRLDRNLWGLAGLNSCPVKEANQSTLENFLERLKTIMREKYSKCSS |
| Form | Liquid |
| Recomended Dilution | Biological Activity<br>SDS-PAGE<br>The optimal working dilution should be determined by the end user. |
| Storage Buffer | In 20mM Tris-HCl (10% glycerol) |
| Gene ID | 3565 |
More info
Human IL4 (P05112, 25 a.a. - 153 a.a.) partial recombinant protein with His tag at N-terminus expressed in Escherichia coli.