View larger
Human IL1B (P01584, 117 a.a. - 269 a.a.) partial recombinant protein with His tag at N-terminus expressed in <i>Escherichia coli
AB-P8218
New product
IL1B (Human) Recombinant Protein
Ao comprar este produto pode ganhar até 2 pontos de fidelização. Seu carrinho totalizará 2 pontos de fidelização que podem ser convertidos num vale de desconto de 8.00EUR.
Data sheet
| Size | 20 ug |
| Gene Name | IL1B |
| Gene Alias | IL-1|IL1-BETA|IL1F2 |
| Gene Description | interleukin 1, beta |
| Storage Conditions | Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Immunogen Prot. Seq | APVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFV_x005F_x000D__x000D__x005F_x000D__x000D_QGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKME_x005F_x000D__x000D__x005F_x000D__x000D_KRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS |
| Form | Liquid |
| Recomended Dilution | Biological Activity<br>SDS-PAGE<br>The optimal working dilution should be determined by the end user. |
| Storage Buffer | In 20mM Tris-HCl buffer pH 8.0 (50% glycerol) |
| Gene ID | 3553 |
More info
Human IL1B (P01584, 117 a.a. - 269 a.a.) partial recombinant protein with His tag at N-terminus expressed in Escherichia coli.