View larger
Human FGF2 (P09038) recombinant protein expressed in <i>Escherichia coli</i>.
AB-P8130
New product
FGF2 (Human) Recombinant Protein
Ao comprar este produto pode ganhar até 11 pontos de fidelização. Seu carrinho totalizará 11 pontos de fidelização que podem ser convertidos num vale de desconto de 44.00EUR.
Data sheet
| Size | 1 mg |
| Gene Name | FGF2 |
| Gene Alias | BFGF|FGFB|HBGF-2 |
| Gene Description | fibroblast growth factor 2 (basic) |
| Storage Conditions | Lyophilized although stable at room temperature for 3 weeks, should be stored desiccated below -20ºC. Upon reconstitution should be stored at 4ºC between 2-7 days and for future use below -20ºC.<br>Aliquot to avoid repeated freezing and thawing._x005F_x00 |
| Immunogen Prot. Seq | AAGSITTLPALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS |
| Form | Lyophilized |
| Antigen species Target species | Human |
| Storage Buffer | Lyophilized from 20mM Tris-HCl, pH7.4 and 1M NaCl |
| Gene ID | 2247 |
More info
Human FGF2 (P09038) recombinant protein expressed in Escherichia coli.