View larger
Human PDGFA/PDGFB (P01127|P04085) recombinant protein expressed in <i>Escherichia coli</i>.
AB-P8129
New product
PDGFA/PDGFB (Human) Recombinant Protein
Ao comprar este produto pode ganhar até 4 pontos de fidelização. Seu carrinho totalizará 4 pontos de fidelização que podem ser convertidos num vale de desconto de 16.00EUR.
Data sheet
| Size | 2 x 10 ug |
| Gene Name | PDGFA |
| Gene Alias | PDGF-A|PDGF1 |
| Gene Description | platelet-derived growth factor alpha polypeptide |
| Storage Conditions | Lyophilized although stable at room temperature for 3 weeks, should be stored desiccated below -20ºC. Upon reconstitution should be stored at 4ºC between 2-7 days and for future use below -20ºC.<br>Aliquot to avoid repeated freezing and thawing._x005F_x00 |
| Immunogen Prot. Seq | PDGFA:MSIEEAVPAVCKTRTVIYEIPRSQVDPTSANFLIWPPCVEVKRCTGCCNTSSVKCQPSRVHHRSVKVAKVEYVRKKPKLKEVQVRLEEHLECACATTSLNPDYREEDTGRPRESGKKRKRKRLKPT.<br>_x005F_x005F_x005F_x000D__x005F_x000D_PDGFB: SLGSLTIAEPAMIAECKTRTEVFEISRRLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQCRPTQVQLRPVQVR |
| Form | Lyophilized |
| Antigen species Target species | Human |
| Storage Buffer | Lyophilized from 10mM AcOH |
| Gene ID | 5154|5155 |
More info
Human PDGFA/PDGFB (P01127|P04085) recombinant protein expressed in Escherichia coli.