TEK (Human) Recombinant Protein View larger

Human TEK (Q02763, 23 a.a. - 748 a.a.) partial length recombinant protein hIgG-His tag expressed in Baculovirus expression syste

AB-P8075

New product

TEK (Human) Recombinant Protein

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 6 pontos de fidelização. Seu carrinho totalizará 6 pontos de fidelização que podem ser convertidos num vale de desconto de 24.00EUR.


Data sheet

Size 100 ug
Gene Name TEK
Gene Alias CD202B|TIE-2|TIE2|VMCM|VMCM1
Gene Description TEK tyrosine kinase, endothelial
Storage Conditions Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing.
Immunogen Prot. Seq AMDLILINSLPLVSDAETSLTCIASGWRPHEPITIGRDFEALMNQHQDPLEVTQDVTREWAKKVVWKREKASKINGAYFCEGRVRGEAIRIRTMKMRQQASFLPATLTMTVDKGDNVNISFKKVLIKEEDAVIYKNGSFIHSVPRHEVPDILEVHLPHAQPQDAGVYSARYIGGNLFTSAFTRLIVRRCEAQKWGPECNHLCTACMNNGVCHEDTGECICPPGFMGRTCEKACELHTFGRTCKERCSGQEGCKSY
Form Liquid
Quality control testing 3 ug by SDS-PAGE under reducing condition and visualized by Coomassie blue stain.
Storage Buffer In Phosphate-Buffer Saline pH 7.4 (10% glycerol)
Gene ID 7010

More info

Human TEK (Q02763, 23 a.a. - 748 a.a.) partial length recombinant protein hIgG-His tag expressed in Baculovirus expression system.

Enviar uma mensagem

Human TEK (Q02763, 23 a.a. - 748 a.a.) partial length recombinant protein hIgG-His tag expressed in Baculovirus expression syste

Human TEK (Q02763, 23 a.a. - 748 a.a.) partial length recombinant protein hIgG-His tag expressed in Baculovirus expression syste