TNFRSF10B (Human) Recombinant Protein View larger

Human TNFRSF10B (O14763, 56 a.a. - 210 a.a.) partial length recombinant protein with hIgG-His tag expressed in Baculovirus expre

AB-P8039

New product

TNFRSF10B (Human) Recombinant Protein

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 4 pontos de fidelização. Seu carrinho totalizará 4 pontos de fidelização que podem ser convertidos num vale de desconto de 16.00EUR.


Data sheet

Size 50 ug
Gene Name TNFRSF10B
Gene Alias CD262|DR5|KILLER|KILLER/DR5|TRAIL-R2|TRAILR2|TRICK2|TRICK2A|TRICK2B|TRICKB|ZTNFR9
Gene Description tumor necrosis factor receptor superfamily, member 10b
Storage Conditions Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing.
Immunogen Prot. Seq ITQQDLAPQQRAAPQQKRSSPSEGLCPPGHHISEDGRDCISCKYGQDYSTHWNDLLFCLRCTRCDSGEVELSPCTTTRNTVCQCEEGTFREEDSPEMCRKCRTGCPRGMVKVGDCTPWSDIECVHKESGTKHSGEVPAVEETVTS
Form Liquid
Quality control testing 3 ug by SDS-PAGE under reducing condition and visualized by Coomassie blue stain.
Storage Buffer In Phosphate-Buffer Saline pH 7.4 (10% glycerol)
Gene ID 8795

More info

Human TNFRSF10B (O14763, 56 a.a. - 210 a.a.) partial length recombinant protein with hIgG-His tag expressed in Baculovirus expression system.

Enviar uma mensagem

Human TNFRSF10B (O14763, 56 a.a. - 210 a.a.) partial length recombinant protein with hIgG-His tag expressed in Baculovirus expre

Human TNFRSF10B (O14763, 56 a.a. - 210 a.a.) partial length recombinant protein with hIgG-His tag expressed in Baculovirus expre