View larger
Human CD48 (P09326, 27 a.a. - 220 a.a.) partial length recombinant protein with His tag expressed in Baculovirus expression syst
AB-P8024
New product
CD48 (Human) Recombinant Protein
Ao comprar este produto pode ganhar até 6 pontos de fidelização. Seu carrinho totalizará 6 pontos de fidelização que podem ser convertidos num vale de desconto de 24.00EUR.
Data sheet
| Size | 100 ug |
| Gene Name | CD48 |
| Gene Alias | BCM1|BLAST|BLAST1|MEM-102|SLAMF2|hCD48|mCD48 |
| Gene Description | CD48 molecule |
| Storage Conditions | Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Immunogen Prot. Seq | QGHLVHMTVVSGSNVTLNISESLPENYKQLTWFYTFDQKIVEWDSRKSKYFESKFKGRVRLDPQSGALYISKVQKEDNSTYIMRVLKKTGNEQEWKIKLQVLDPVPKPVIKIEKIEDMDDNCYLKLSCVIPGESVNYTWYGDKRPFPKELQNSVLETTLMPHNYSRCYTCQVSNSVSSKNGTVC |
| Form | Liquid |
| Quality control testing | 3 ug by SDS-PAGE under reducing condition and visualized by Coomassie blue stain. |
| Storage Buffer | In Phosphate-Buffer Saline pH 7.4 (10% glycerol) |
| Gene ID | 962 |
More info
Human CD48 (P09326, 27 a.a. - 220 a.a.) partial length recombinant protein with His tag expressed in Baculovirus expression system.