View larger
Human IL3 (P08700, 20 a.a. - 152 a.a.) partial length recombinant protein with His tag expressed in Baculovirus expression syste
AB-P7976
New product
IL3 (Human) Recombinant Protein
Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.
Data sheet
| Size | 20 ug |
| Gene Name | IL3 |
| Gene Alias | IL-3|MCGF|MGC79398|MGC79399|MULTI-CSF |
| Gene Description | interleukin 3 (colony-stimulating factor, multiple) |
| Storage Conditions | Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Immunogen Prot. Seq | APMTQTTPLKTSWVNCSNMIDEIITHLKQPPLPLLDFNNLNGEDQDILMENNLRRPNLEAFNRAVKSLQNASAIESILKNLLPCLPLATAAPTRHPIHIKDGDWNEFRRKLTFYLKTLENAQAQQTTLSLAIF |
| Form | Liquid |
| Quality control testing | 3 ug by SDS-PAGE under reducing condition and visualized by Coomassie blue stain. |
| Storage Buffer | In Phosphate-Buffer Saline pH 7.4 (10% glycerol) |
| Gene ID | 3562 |
More info
Human IL3 (P08700, 20 a.a. - 152 a.a.) partial length recombinant protein with His tag expressed in Baculovirus expression system.