Ces2e (Mouse) Recombinant Protein View larger

Mouse Ces2e (Q8BK48, 27 a.a. - 559 a.a.) partial length recombinant protein with His tag expressed in Baculovirus expression sys

AB-P7967

New product

Ces2e (Mouse) Recombinant Protein

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 11 pontos de fidelização. Seu carrinho totalizará 11 pontos de fidelização que podem ser convertidos num vale de desconto de 44.00EUR.


Data sheet

Size 250 ug
Gene Name Ces5
Gene Alias 9030624L02Rik
Gene Description carboxylesterase 5
Storage Conditions Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq QDSASPIRNTHTGQVRGSLVHVKDTDIAVHTFLGIPFAKPPVGPLRFAPPEAPEPWSGVRDGTSHPNMCLQNDNLMGSEDLKMMNLILPPISMSEDCLYLNIYVPAHAHEGSNLPVMVWIHGGALTVGMASMYDGSMLAATEDVVVVAIQYRLGVLGFFSTGDQHAKGNWGYLDQVAALRWVQQNIVHFGGNPDRVTIFGESAGGTSVSSHVVSPMSQGLFHGAIMESGVAVLPDLISSSSEMVHRIVANLSGCA
Form Liquid
Quality control testing 3 ug by SDS-PAGE under reducing condition and visualized by Coomassie blue stain.
Storage Buffer In Phosphate-Buffer Saline pH 7.4 (10% glycerol)
Gene ID 234673

More info

Mouse Ces2e (Q8BK48, 27 a.a. - 559 a.a.) partial length recombinant protein with His tag expressed in Baculovirus expression system.

Enviar uma mensagem

Mouse Ces2e (Q8BK48, 27 a.a. - 559 a.a.) partial length recombinant protein with His tag expressed in Baculovirus expression sys

Mouse Ces2e (Q8BK48, 27 a.a. - 559 a.a.) partial length recombinant protein with His tag expressed in Baculovirus expression sys