View larger
Mouse Il3ra (P26952, 17 a.a. - 331 a.a.) partial recombinant protein with hIgG-His tag expressed in Baculovirus.
AB-P7918
New product
Il3ra (Mouse) Recombinant Protein
Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.
Data sheet
| Size | 50 ug |
| Gene Name | Il3ra |
| Gene Alias | CD123|CDw123|SUT-1 |
| Gene Description | interleukin 3 receptor, alpha chain |
| Storage Conditions | Store at 4ºC for 1 week. For long term storage store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | SDS-PAGE |
| Immunogen Prot. Seq | SDLAAVREAPPTAVTTPIQNLHIDPAHYTLSWDPAPGADITTGAFCRKGRDIFVWADPGLARCSFQSLSLCHVTNFTVFLGKDRAVAGSIQFPPDDDGDHEAAAQDLRCWVHEGQLSCQWERGPKATGDVHYRMFWRDVRLGPAHNRECPHYHSLDVNTAGPAPHGGHEGCTLDLDTVLGSTPNSPDLVPQVTITVNGSGRAGPVPCMDNTVDLQRAEVLAPPTLTVECNGSEAHARWVARNRFHHGLLGYTLQV |
| Form | Liquid |
| Recomended Dilution | Biological Activity<br>SDS-PAGE<br>The optimal working dilution should be determined by the end user. |
| Antigen species Target species | Mouse |
| Quality control testing | SDS-PAGE Stained with Coomassie Blue. |
| Storage Buffer | In 20mM Tris-HCl buffer, 0.1M NaCl, pH 8.0 (30% glycerol) |
| Gene ID | 16188 |
More info
Mouse Il3ra (P26952, 17 a.a. - 331 a.a.) partial recombinant protein with hIgG-His tag expressed in Baculovirus.