FOLH1 (Human) Recombinant Protein View larger

Human FOLH1 (Q04609, 44 a.a. - 750 a.a.) partial recombinant protein with His tag expressed in Baculovirus.

AB-P7883

New product

FOLH1 (Human) Recombinant Protein

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 22 pontos de fidelização. Seu carrinho totalizará 22 pontos de fidelização que podem ser convertidos num vale de desconto de 88.00EUR.


Data sheet

Size 500 ug
Gene Name FOLH1
Gene Alias FGCP|FOLH|GCP2|GCPII|NAALAD1|NAALAdase|PSM|PSMA|mGCP
Gene Description folate hydrolase (prostate-specific membrane antigen) 1
Storage Conditions Store at 4ºC for 1 week. For long term storage store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing.
Application Key SDS-PAGE
Immunogen Prot. Seq KSSNEATNITPKHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIG
Form Liquid
Recomended Dilution SDS-PAGE<br>The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Quality control testing SDS-PAGE Stained with Coomassie Blue.
Storage Buffer In PBS, pH 7.4 ( 20% glycerol)
Gene ID 2346

More info

Human FOLH1 (Q04609, 44 a.a. - 750 a.a.) partial recombinant protein with His tag expressed in Baculovirus.

Enviar uma mensagem

Human FOLH1 (Q04609, 44 a.a. - 750 a.a.) partial recombinant protein with His tag expressed in Baculovirus.

Human FOLH1 (Q04609, 44 a.a. - 750 a.a.) partial recombinant protein with His tag expressed in Baculovirus.