View larger
Human CSNK2B (P67870, 1 a.a. - 215 a.a.) full-length recombinant protein expressed in <i>Escherichia coli</i>.
AB-P7877
New product
CSNK2B (Human) Recombinant Protein
Ao comprar este produto pode ganhar até 17 pontos de fidelização. Seu carrinho totalizará 17 pontos de fidelização que podem ser convertidos num vale de desconto de 68.00EUR.
Data sheet
| Size | 500 ug |
| Gene Name | CSNK2B |
| Gene Alias | CK2B|CK2N|CSK2B|G5A|MGC138222|MGC138224 |
| Gene Description | casein kinase 2, beta polypeptide |
| Storage Conditions | Store at 4ºC for 1 week. For long term storage store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | SDS-PAGE |
| Immunogen Prot. Seq | MSSSEEVSWISWFCGLRGNEFFCEVDEDYIQDKFNLTGLNEQVPHYRQALDMILDLEPDEELEDNPNQSDLIEQAAEMLYGLIHARYILTNRGIAQMLEKYQQGDFGYCPRVYCENQPMLPIGLSDIPGEAMVKLYCPKCMDVYTPKSSRHHHTDGAYFGTGFPHMLFMVHPEYRPKRPANQFVPRLYGFKIHPMAYQLQLQAASNFKSPVKTIR |
| Form | Liquid |
| Recomended Dilution | SDS-PAGE<br>The optimal working dilution should be determined by the end user. |
| Antigen species Target species | Human |
| Quality control testing | SDS-PAGE Stained with Coomassie Blue. |
| Storage Buffer | In 20mM Tris-HCl buffer, 0.15M NaCl, pH 8.0 (10% glycerol, 1mM DTT, 1mM EDTA) |
| Gene ID | 1460 |
More info
Human CSNK2B (P67870, 1 a.a. - 215 a.a.) full-length recombinant protein expressed in Escherichia coli.