Thbs4 (Mouse) Recombinant Protein View larger

Mouse Thbs4 (Q9Z1T2, 27 a.a. - 963 a.a.) partial recombinant protein expressed in HEK293 cells.

AB-P7865

New product

Thbs4 (Mouse) Recombinant Protein

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 5 pontos de fidelização. Seu carrinho totalizará 5 pontos de fidelização que podem ser convertidos num vale de desconto de 20.00EUR.


Data sheet

Size 50 ug
Gene Name Thbs4
Gene Alias TSP-4|TSP4
Gene Description thrombospondin 4
Storage Conditions Store at 4ºC for 1 week. For long term storage store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing.
Application Key SDS-PAGE
Immunogen Prot. Seq QATPQVFDLLPSSSQRLNPSALQPVLTDPTLHEVYLISTFKLQSKSSATIFGLYSSSDNSKYFEFTVMGRLNKAILRYLKNDGKIHLVVFNNLQLADGRRHRVLLRLSNLQRGDGSVELYLDCAQADSVRNLPRAFSGLTQNPESIELRTFQRKPQDFLEELKLVVRGSLFQVASLQDCFLQQSEPLAATSTGDFNRQFLGQMTQLNQLLGEVKDLLRQQVKETSFLRNTIAECQACGPLSFQSPTPNTLVPIAP
Form Liquid
Recomended Dilution SDS-PAGE<br>The optimal working dilution should be determined by the end user.
Antigen species Target species Mouse
Quality control testing SDS-PAGE Stained with Coomassie Blue.
Storage Buffer In PBS, 0.1mM PMSF, pH 7.4 (20% glycerol)
Gene ID 21828

More info

Mouse Thbs4 (Q9Z1T2, 27 a.a. - 963 a.a.) partial recombinant protein expressed in HEK293 cells.

Enviar uma mensagem

Mouse Thbs4 (Q9Z1T2, 27 a.a. - 963 a.a.) partial recombinant protein expressed in HEK293 cells.

Mouse Thbs4 (Q9Z1T2, 27 a.a. - 963 a.a.) partial recombinant protein expressed in HEK293 cells.