L1CAM (Human) Recombinant Protein View larger

Human L1CAM (P63302, 20 a.a. - 1115 a.a.) partial recombinant protein with His tag expressed in Baculovirus.

AB-P7862

New product

L1CAM (Human) Recombinant Protein

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 5 pontos de fidelização. Seu carrinho totalizará 5 pontos de fidelização que podem ser convertidos num vale de desconto de 20.00EUR.


Data sheet

Size 50 ug
Gene Name L1CAM
Gene Alias CAML1|CD171|HSAS|HSAS1|MASA|MIC5|N-CAML1|S10|SPG1
Gene Description L1 cell adhesion molecule
Storage Conditions Store at 4ºC for 1 week. For long term storage store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq IQIPEELMEPPVITEQSPRRLVVFPTDDISLKCEASGKPEVQFRWTRDGVHFKPKEELGVTVYQSPHSGSFTITGNNSNFAQRFQGIYRCFASNKLGTAMSHEIRLMAEGAPKWPKETVKPVEVEEGESVVLPCNPPPSAEPLRIYWMNSKILHIKQDERVTMGQNGNLYFANVLTSDNHSDYICHAHFPGTRTIIQKEPIDLRVKATNSMIDRKPRLLFPTNSSSHLVALQGQPLVLECIAEGFPTPTIKWLRP
Form Liquid
Recomended Dilution Biological Activity<br>SDS-PAGE<br>The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Quality control testing SDS-PAGE Stained with Coomassie Blue.
Storage Buffer In PBS, pH 7.4 (10% glycerol)
Gene ID 3897

More info

Human L1CAM (P63302, 20 a.a. - 1115 a.a.) partial recombinant protein with His tag expressed in Baculovirus.

Enviar uma mensagem

Human L1CAM (P63302, 20 a.a. - 1115 a.a.) partial recombinant protein with His tag expressed in Baculovirus.

Human L1CAM (P63302, 20 a.a. - 1115 a.a.) partial recombinant protein with His tag expressed in Baculovirus.