View larger
Human N6AMT1 (NP_037372, 1 a.a. - 214 a.a ) full-length recombinant protein with His tag expressed in <i>Escherichia coli</i>.
AB-P7721
New product
N6AMT1 (Human) Recombinant Protein
Ao comprar este produto pode ganhar até 5 pontos de fidelização. Seu carrinho totalizará 5 pontos de fidelização que podem ser convertidos num vale de desconto de 20.00EUR.
Data sheet
| Size | 100 ug |
| Gene Name | N6AMT1 |
| Gene Alias | C21orf127|HEMK2|MGC19995|MTQ2|N6AMT|PRED28 |
| Gene Description | N-6 adenine-specific DNA methyltransferase 1 (putative) |
| Storage Conditions | Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Concentration | 0.25mg/mL |
| Application Key | SDS-PAGE |
| Immunogen Prot. Seq | MGSSHHHHHHSSGLVPRGSHMGSMAGENFATPFHGHVGRGAFSDVYEPAEDTFLLLNALEAAAAELAGVEICLEVGSGSGVVSAFLASMIGPQALYMCTDINPEAAACTLETARCNKVHIQPVITDLVKGLLPRLTEKVDLLVFNPPYVVTPPQEVGSHGIEAAWAGGRNGREVMDRFFPLVPDLLSPRGLFYLVTIKENNPEEILKIMKTKGLQGTTALSRQAGQETLSVLKFTKS |
| Form | Liquid |
| Recomended Dilution | SDS-PAGE<br>The optimal working dilution should be determined by the end user. |
| Antigen species Target species | Human |
| Quality control testing | 3ug by SDS-PAGE under reducing condition and visualized by coomassie blue stain. |
| Storage Buffer | In PBS, pH 7.4 (1 mM DTT, 20% glycerol). |
| Gene ID | 29104 |
More info
Human N6AMT1 (NP_037372, 1 a.a. - 214 a.a ) full-length recombinant protein with His tag expressed in Escherichia coli.