View larger
Human EDAR (NP_071731, 27 a.a. - 448 a.a ) partial recombinant protein with His tag expressed in <i>Escherichia coli</i>.
AB-P7680
New product
EDAR (Human) Recombinant Protein
Ao comprar este produto pode ganhar até 11 pontos de fidelização. Seu carrinho totalizará 11 pontos de fidelização que podem ser convertidos num vale de desconto de 44.00EUR.
Data sheet
| Size | 500 ug |
| Gene Name | EDAR |
| Gene Alias | DL|ED1R|ED3|ED5|EDA-A1R|EDA1R|EDA3|FLJ94390 |
| Gene Description | ectodysplasin A receptor |
| Storage Conditions | Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Concentration | 0.25mg/mL |
| Application Key | SDS-PAGE |
| Immunogen Prot. Seq | MGSSHHHHHHSSGLVPRGSHMGSEYSNCGENEYYNQTTGLCQECPPCGPGEEPYLSCGYGTKDEDYGCVPCPAEKFSKGGYQICRRHKDCEGFFRATVLTPGDMENDAECGPCLPGYYMLENRPRNIYGMVCYSCLLAPPNTKECVGATSGASANFPGTSGSSTLSPFQHAHKELSGQGHLATALIIAMSTIFIMAIAIVLIIMFYILKTKPSAPACCTSHPGKSVEAQVSKDEEKKEAPDNVVMFSEKDEFEKL |
| Form | Liquid |
| Recomended Dilution | SDS-PAGE<br>Denatured<br>The optimal working dilution should be determined by the end user. |
| Antigen species Target species | Human |
| Quality control testing | 3ug by SDS-PAGE under reducing condition and visualized by coomassie blue stain. |
| Storage Buffer | In 20 mM Tris-HCl buffer, pH 8.0 (10% glycerol). |
| Gene ID | 10913 |
More info
Human EDAR (NP_071731, 27 a.a. - 448 a.a ) partial recombinant protein with His tag expressed in Escherichia coli.