View larger
Human SLAMF7 (Q9NQ25, 23 a.a. - 226 a.a.) partial recombinant protein with His-Avi tag at C-terminus expressed in Expi293 cells.
AB-P7657
New product
SLAMF7 (Human) Recombinant Protein
Ao comprar este produto pode ganhar até 4 pontos de fidelização. Seu carrinho totalizará 4 pontos de fidelização que podem ser convertidos num vale de desconto de 16.00EUR.
Data sheet
| Size | 100 ug |
| Gene Name | SLAMF7 |
| Gene Alias | 19A|CD319|CRACC|CS1 |
| Gene Description | SLAM family member 7 |
| Storage Conditions | Store at -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | Func,SDS-PAGE |
| Immunogen Prot. Seq | SGPVKELVGSVGGAVTFPLKSKVKQVDSIVWTFNTTPLVTIQPEGGTIIVTQNRNRERVDFPDGGYSLKLSKLKKNDSGIYYVGIYSSSLQQPSTQEYVLHVYEHLSKPKVTMGLQSNKNGTCVTNLTCCMEHGEEDVIYTWKALGQAANESHNGSILPISWRWGESDMTFICVARNPVSRNFSSPILARKLCEGAADDPDSSM |
| Form | Lyophilized |
| Quality control testing | SDS-PAGE under reducing condition |
| Storage Buffer | Lyophilized from sterile distilled Water up to 100 ug/mL |
| Gene ID | 57823 |
More info
Human SLAMF7 (Q9NQ25, 23 a.a. - 226 a.a.) partial recombinant protein with His-Avi tag at C-terminus expressed in Expi293 cells.