View larger
Mouse Mif (P34884, 1 a.a. - 115 a.a.) partial recombinant protein expressed in <i>Escherichia coli</i>.
AB-P7630
New product
Mif (Mouse) Recombinant Protein
Ao comprar este produto pode ganhar até 51 pontos de fidelização. Seu carrinho totalizará 51 pontos de fidelização que podem ser convertidos num vale de desconto de 204.00EUR.
Data sheet
| Size | 1 mg |
| Gene Name | Mif |
| Gene Alias | GIF|Glif|MGC107654 |
| Gene Description | macrophage migration inhibitory factor |
| Storage Conditions | Store at 4ºC to 8ºC for 1 week. For long term storage store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | SDS-PAGE |
| Immunogen Prot. Seq | MPMFIVNTNVPRASVPEGFLSELTQQLAQATGKPAQYIAVHVVPDQLMTFSGTNDPCALCSLHSIGKIGGAQNRNYSKLLCGLLSDRLHISPDRVYINYYDMNAANVGWNGSTFA |
| Form | Lyophilized |
| Storage Buffer | Lyophilized from sterile distilled Water up to 0.1 - 1.0 mg/mL |
| Gene ID | 17319 |
More info
Mouse Mif (P34884, 1 a.a. - 115 a.a.) partial recombinant protein expressed in Escherichia coli.