View larger
Human SIGLEC15 (Q6ZMC9, 20 a.a. - 263 a.a.) partial recombinant protein with hFc tag at C-terminus expressed in HEK293 cells.
AB-P7620
New product
SIGLEC15 (Human) Recombinant Protein
Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.
Data sheet
| Size | 50 ug |
| Gene Name | SIGLEC15 |
| Gene Alias | CD33L3|HsT1361|SIGLEC-15 |
| Gene Description | sialic acid binding Ig-like lectin 15 |
| Storage Conditions | Store at 4ºC to 8ºC for 1 week. For long term storage store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | Func,SDS-PAGE |
| Immunogen Prot. Seq | FVRTKIDTTENLLNTEVHSSPAQRWSMQVPPEVSAEAGDAAVLPCTFTHPHRHYDGPLTAIWRAGEPYAGPQVFRCAAARGSELCQTALSLHGRFRLLGNPRRNDLSLRVERLALADDRRYFCRVEFAGDVHDRYESRHGVRLHVTAAPRIVNISVLPSPAHAFRALCTAEGEPPPALAWSGPALGNSLAAVRSPREGHGHLVTAELPALTHDGRYTCTAANSLGRSEASVYLFRFHGASGAST |
| Form | Lyophilized |
| Storage Buffer | Lyophilized from sterile distilled Water up to 100 ug/mL |
| Gene ID | 284266 |
More info
Human SIGLEC15 (Q6ZMC9, 20 a.a. - 263 a.a.) partial recombinant protein with hFc tag at C-terminus expressed in HEK293 cells.