View larger
Human CD47 (Q9BQ51, 19 a.a. - 139 a.a.) partial recombinant protein with His tag at C-terminus expressed in HEK293 cell.
AB-P7570
New product
CD47 (Human) Recombinant Protein
Ao comprar este produto pode ganhar até 26 pontos de fidelização. Seu carrinho totalizará 26 pontos de fidelização que podem ser convertidos num vale de desconto de 104.00EUR.
Data sheet
| Size | 1 mg |
| Gene Name | CD47 |
| Gene Alias | IAP|MER6|OA3 |
| Gene Description | CD47 molecule |
| Storage Conditions | Store at 4ºC to 8ºC for 1 week. For long term storage store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | Func,SDS-PAGE |
| Immunogen Prot. Seq | QLLFNKTKSVEFTFCNDTVVIPCFVTNMEAQNTTEVYVKWKFKGRDIYTFDGALNKSTVPTDFSSAKIEVSQLLKGDASLKMDKSDAVSHTGNYTCEVTELTREGETIIELKYRVVSWFSP |
| Form | Lyophilized |
| Storage Buffer | Lyophilized from sterile distilled Water up to 100 ug/mL |
| Gene ID | 961 |
More info
Human CD47 (Q9BQ51, 19 a.a. - 139 a.a.) partial recombinant protein with His tag at C-terminus expressed in HEK293 cell.