View larger
Mouse Tnfrsf4 (P47741, 20 a.a. - 211 a.a.) partial recombinant protein with hFc tag at C-terminus expressed in HEK294 cell.
AB-P7557
New product
Tnfrsf4 (Mouse) Recombinant Protein
Ao comprar este produto pode ganhar até 22 pontos de fidelização. Seu carrinho totalizará 22 pontos de fidelização que podem ser convertidos num vale de desconto de 88.00EUR.
Data sheet
| Size | 1 mg |
| Gene Name | Tnfrsf4 |
| Gene Alias | ACT35|CD134|Ly-70|Ox40|TXGP1L|Txgp1 |
| Gene Description | tumor necrosis factor receptor superfamily, member 4 |
| Storage Conditions | Store at 4ºC to 8ºC for 1 week. For long term storage store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | Func,SDS-PAGE |
| Immunogen Prot. Seq | VTARRLNCVKHTYPSGHKCCRECQPGHGMVSRCDHTRDTLCHPCETGFYNEAVNYDTCKQCTQCNHRSGSELKQNCTPTQDTVCRCRPGTQPRQDSGYKLGVDCVPCPPGHFSPGNNQACKPWTNCTLSGKQTRHPASDSLDAVCEDRSLLATLLWETQRPTFRPTTVQSTTVWPRTSELPSPPTLVTPEGP |
| Form | Lyophilized |
| Storage Buffer | Lyophilized from sterile distilled Water up to 100 ug/mL |
| Gene ID | 22163 |
More info
Mouse Tnfrsf4 (P47741, 20 a.a. - 211 a.a.) partial recombinant protein with hFc tag at C-terminus expressed in HEK294 cell.