View larger
Human IL15 (P40933, 49 a.a. - 162 a.a.) partial recombinant protein with His tag expressed at N-terminus in <i>Escherichia coli<
AB-P7503
New product
IL15 (Human) Recombinant Protein
Ao comprar este produto pode ganhar até 2 pontos de fidelização. Seu carrinho totalizará 2 pontos de fidelização que podem ser convertidos num vale de desconto de 8.00EUR.
Data sheet
| Size | 10 ug |
| Gene Name | IL15 |
| Gene Alias | IL-15|MGC9721 |
| Gene Description | interleukin 15 |
| Storage Conditions | Store at 4ºC to 8ºC for 1 week. For long term storage store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | Func,SDS-PAGE |
| Immunogen Prot. Seq | NWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTVENLIILANNSLSSNGNVTESGCKECEELEEKNIKEFLQSFVHIVQMFINTS |
| Form | Lyophilized |
| Storage Buffer | Lyophilized from sterile distilled Water up to 100 ug/mL |
| Gene ID | 3600 |
More info
Human IL15 (P40933, 49 a.a. - 162 a.a.) partial recombinant protein with His tag expressed at N-terminus in Escherichia coli.