View larger
Human CXCL2 (P19875, 35 a.a. - 107 a.a.) partial recombinant protein expressed in <i>Escherichia coli</i>.
AB-P7499
New product
CXCL2 (Human) Recombinant Protein
Ao comprar este produto pode ganhar até 1 ponto de fidelização. Seu carrinho totalizará 1 ponto de fidelização que podem ser convertidos num vale de desconto de 4.00EUR.
Data sheet
| Size | 5 ug |
| Gene Name | CXCL2 |
| Gene Alias | CINC-2a|GRO2|GROb|MGSA-b|MIP-2a|MIP2|MIP2A|SCYB2 |
| Gene Description | chemokine (C-X-C motif) ligand 2 |
| Storage Conditions | Store at 4ºC to 8ºC for 1 week. For long term storage store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | Func,SDS-PAGE |
| Immunogen Prot. Seq | APLATELRCQCLQTLQGIHLKNIQSVKVKSPGPHCAQTEVIATLKNGQKACLNPASPMVKKIIEKMLKNGKSN |
| Form | Lyophilized |
| Storage Buffer | Lyophilized from sterile distilled Water up to 100 ug/mL |
| Gene ID | 2920 |
More info
Human CXCL2 (P19875, 35 a.a. - 107 a.a.) partial recombinant protein expressed in Escherichia coli.