View larger
Mouse Tnfsf18 (Q7TS55, 47 a.a. - 173 a.a.) partial recombinant protein expressed in <i>Escherichia coli</i>.
AB-P7358
New product
Tnfsf18 (Mouse) Recombinant Protein
Ao comprar este produto pode ganhar até 1 ponto de fidelização. Seu carrinho totalizará 1 ponto de fidelização que podem ser convertidos num vale de desconto de 4.00EUR.
Data sheet
| Size | 10 ug |
| Gene Name | Tnfsf18 |
| Gene Alias | Gitrl |
| Gene Description | tumor necrosis factor (ligand) superfamily, member 18 |
| Storage Conditions | Store at 4ºC to 8ºC for 1 week. For long term storage store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | Func,SDS-PAGE |
| Immunogen Prot. Seq | TAIESCMVKFELSSSKWHMTSPKPHCVNTTSDGKLKILQSGTYLIYGQVIPVDKKYIKDNAPFVVQIYKKNDVLQTLMNDFQILPIGGVYELHAGDNIYLKFNSKDHIQKTNTYWGIILMPDLPFIS |
| Form | Lyophilized |
| Recomended Dilution | Biological Activity<br>SDS-PAGE<br>The optimal working dilution should be determined by the end user. |
| Antigen species Target species | Mouse |
| Storage Buffer | Lyophilized from PBS. Reconstitute the lyophilized powder in ddH<sub>2</sub>O up to 100 ug/mL. |
| Gene ID | 240873 |
More info
Mouse Tnfsf18 (Q7TS55, 47 a.a. - 173 a.a.) partial recombinant protein expressed in Escherichia coli.